PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA102G00135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family HB-PHD
Protein Properties Length: 713aa    MW: 81741.8 Da    PI: 4.6647
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA102G00135genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.63.2e-11432476953
                  HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
     Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                  +  +e L ++F++n  ps++ r e +k+l+L+ ++V+ WF+N R+
  AA102G00135 432 RAAVEKLRRVFAENELPSKAVRDEVSKELNLDPEKVSKWFKNARY 476
                  667899*************************************97 PP

2PHD41.33.5e-14175229150
                  SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
          PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCke 50 
                  +C+ C++ ++  +++++lCd +C+++fH+kCl+++l++e++p g   w+C+ C +
  AA102G00135 175 FCAECNSREAfiDNDIILCDgTCNRAFHQKCLDPPLDTENIPPGdqGWFCKFCVC 229
                  6999***55567********56********************9999*******87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.55E-14167233IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.5E-12171231IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.789173230IPR019787Zinc finger, PHD-finger
CDDcd155041.34E-31175227No hitNo description
SMARTSM002497.8E-10175228IPR001965Zinc finger, PHD-type
PfamPF006282.6E-11175229IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590176227IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.609.8E-13413475IPR009057Homeodomain-like
PROSITE profilePS5007113.491421481IPR001356Homeobox domain
SuperFamilySSF466891.8E-10422486IPR009057Homeodomain-like
SMARTSM003892.0E-11423485IPR001356Homeobox domain
CDDcd000862.20E-9424476No hitNo description
PfamPF000461.0E-8432476IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MGEIKGRSGK EPEKPCEIGS TLLSSFLKKG GNAAKRRKYK KSETNDRRIS YKKHSRGVEC  60
EEKKVKRRRK KKSKRETGKV ELDEALRLQR RARYLLIKMK WQQNLIDAYA TEGWKGQSRE  120
KIRPDKELER ARKQILNCKL GLREAIHQLD LLSSVGSIEE KVMAPDGSIH HEHIFCAECN  180
SREAFIDNDI ILCDGTCNRA FHQKCLDPPL DTENIPPGDQ GWFCKFCVCK MEIIDSMNAQ  240
TGTHFPSDSN WQDIFKEEAN LPNGSEATLN NEVDWPSDDS EDDDYDPETK EIGNLSLASD  300
GENGENSSSS VSLSSDGEGL SINEGNNRFE LGETSNEEVI VSGTRQRRTV DYTKLYYDMF  360
GKDAVLHEQG SEDEDWGPSN RRKRKKEADS ATTVLRLCES SKKDQDNVEL PEFGERDSME  420
DKGRKPSSRL PRAAVEKLRR VFAENELPSK AVRDEVSKEL NLDPEKVSKW FKNARYMALR  480
NRKTENLQQP QDSKAASGDS GVKENITETN ETQEAIDDEN LLLGLNDSCT NQDLIPSVDN  540
LEDDQKAKES AFTPAEEQEQ EQEQEQEQEQ DEEQEQEEDK EQEQEEDLQS SDELRGDMSL  600
EMAEEKRSKE EEVVIYKEAI DMINRAQNML KSPDELSGEM SLEMAEERFS KEYEVYEAAM  660
EMICRAQNIL LGMKVRLNRV KPQRKNRKKL GKSVNLPEEE RIVYVPIAEI KER
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16571KRRRKKK
26674RRRKKKSKR
36875RKKKSKRE
4381385RKRKK
5381386RKRKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867379.10.0hypothetical protein ARALYDRAFT_913493
SwissprotP487850.0PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLD7MCG10.0D7MCG1_ARALL; Putative uncharacterized protein
STRINGscaffold_701235.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.10.0pathogenesis related homeodomain protein A